PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn121851
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 220aa    MW: 24602 Da    PI: 8.8619
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn121851genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.94.8e-1373118247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++WT+eE++l++ + ++ G+g+W+ I++ + k+R + q+ s+ qky
       Achn121851  73 LPWTEEEHKLFLLGLQKVGKGDWRGISKNFVKTRKPTQVASHAQKY 118
                      69*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.48367123IPR017930Myb domain
SuperFamilySSF466898.97E-1669124IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-1570121IPR006447Myb domain, plants
SMARTSM007179.3E-971121IPR001005SANT/Myb domain
CDDcd001676.41E-974119No hitNo description
PfamPF002491.4E-1074118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-1074118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MSHSADCAVA GDEIMLFGVR VKVDPMRKSV SMNDLSQYEQ PHESSIAGGG GYASANDTIH  60
RQSSGSRERK RGLPWTEEEH KLFLLGLQKV GKGDWRGISK NFVKTRKPTQ VASHAQKYFL  120
RRNNVNRHRR RSSLFDITTE SITAIPMEEE TVHQETKTQP LLPRTQLLPL ESTNISGSQV  180
LPCQVSVCPV LIPVQIENPM EQLTLGRLDQ EIVAINFQL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00149DAPTransfer from AT1G19000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006476696.17e-76PREDICTED: transcription factor MYB1R1-like
SwissprotQ2V9B02e-70MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLF8SPH02e-79F8SPH0_CAMSI; MYB transcription factor 1
STRINGSolyc06g071230.2.14e-70(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25742351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19000.25e-51MYB_related family protein